Protein Info for AMB_RS15475 in Magnetospirillum magneticum AMB-1

Annotation: bile acid:sodium symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 92 to 121 (30 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details PF01758: SBF" amino acids 8 to 192 (185 residues), 107.6 bits, see alignment E=6.5e-35 PF13593: SBF_like" amino acids 9 to 265 (257 residues), 70.9 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 100% identity to mag:amb3073)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2P8 at UniProt or InterPro

Protein Sequence (286 amino acids)

>AMB_RS15475 bile acid:sodium symporter family protein (Magnetospirillum magneticum AMB-1)
MITQAALPLALAFIMFAMGLTMDGRDFRVVFGSPKALAVGLGAKLVLLPALGLALVLAWR
PEPDFAVGMILLAACPAGVTSALLTHHAGGRIALAATITALTSLAATLTVPLLVNVGLAL
FAGYDRSVEIPVAKMTLGIFLVDTVPLVLGLVLQRSWPGLAGRLGRVARPVATLLFALIV
VGAFVSQRQALIDHVGDVVPAALILNLAAMTGAWALGAAARLDLADRIAVVMENGLQNGA
LGIFVAVTLLGNPAMMVPSIVYAFVMNLTAVAFILAVKRRRRVVTG