Protein Info for AMB_RS15465 in Magnetospirillum magneticum AMB-1

Annotation: DUF898 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 70 to 95 (26 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details PF05987: DUF898" amino acids 13 to 349 (337 residues), 265.6 bits, see alignment E=3.4e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3071)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2Q0 at UniProt or InterPro

Protein Sequence (358 amino acids)

>AMB_RS15465 DUF898 domain-containing protein (Magnetospirillum magneticum AMB-1)
MRQSTTPQRPLVCSGDVGNMISTALSNMLLSILTLSIYRFWGKTNVRRQLWSATRAWGDP
LEYTGTGKELFIGFLIVLVIVYLPLVAGFASAQVLLVSGNPLGALLLSGLYLLTILLVSV
GLYRARRYQMSRTLWRGIRGGQTGSGWGYALRSLAVWMAVPLSLGWALPWGEMWLASYRL
NNTTFGDRRFTCDATASGLYGRFTLVWFSGLIFAVAAIAAAAGASSLVGESEEDQAAAGI
GFAMLLVPVAVVTMALPLAWYRAGFYRNLAAGTEFEGSRFSADTRAWRLIGLVMGNMLIS
LFSFGILRPWASLRTFRYACSVIGVEGEPDFARVHRAEDTGPSTGEGLVAVLDGAGEF