Protein Info for AMB_RS15310 in Magnetospirillum magneticum AMB-1

Annotation: adenylate/guanylate cyclase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details amino acids 31 to 31 (1 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details PF00111: Fer2" amino acids 257 to 330 (74 residues), 36.7 bits, see alignment E=3.3e-13 PF00211: Guanylate_cyc" amino acids 360 to 538 (179 residues), 49.5 bits, see alignment E=4e-17

Best Hits

KEGG orthology group: K01768, adenylate cyclase [EC: 4.6.1.1] (inferred from 100% identity to mag:amb3040)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2T1 at UniProt or InterPro

Protein Sequence (548 amino acids)

>AMB_RS15310 adenylate/guanylate cyclase domain-containing protein (Magnetospirillum magneticum AMB-1)
MGIRADLRLAGALVILAFVVCHLANHMLALVSLDAAMAGHEILMEPWEGALGGGLLMAAG
LTHYANALWAVYERRTLRMGGSEAWQLGLGLLIPFLMMIHLAGTGLGEALLDLEPGYPSV
LLGQWVMSPWRGLAQAILVLVVWGHACSGLHLRYGGRDRYERAKPWLLALAVVIPTLALA
GWVSGGAQVMRSAADPAWTGRVLAEARMGPSTLDDTLRLALAGMGLHLLLIATPFAGRLL
RHVGGGRRPQLTHSNGRVIRMMPGSTVLEALQDHAIAHASACGGKGRCTTCRVRVRSGVE
KLPSPGPLEANALGRIEAPPEVRLACQLRPEHDLTILPLLPSDAVAADGRLHGGLDGRER
QIVVVFIDLRGSTTLGEAKMPYDMLFILHRFFQQMTRALTATGGHYSNFTGDGLMALYGL
KGNDSAKAVTAALAGAREMVAGLDKLNAELAMELEAPLRMGIGIHYGQAIVGTMGPPGAQ
IVSAIGDTVNTTARLEGLTKDHDCLLVLSAAAAEAGGLSFPGIPRHQVAVKGRVEAVEFY
AFGEIPGR