Protein Info for AMB_RS15240 in Magnetospirillum magneticum AMB-1

Annotation: Fe-S protein assembly co-chaperone HscB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF00226: DnaJ" amino acids 39 to 107 (69 residues), 32.7 bits, see alignment E=6.6e-12 TIGR00714: Fe-S protein assembly co-chaperone HscB" amino acids 50 to 201 (152 residues), 84.7 bits, see alignment E=3.7e-28 PF07743: HSCB_C" amino acids 126 to 196 (71 residues), 60.3 bits, see alignment E=2e-20

Best Hits

KEGG orthology group: K04082, molecular chaperone HscB (inferred from 100% identity to mag:amb3025)

Predicted SEED Role

"Chaperone protein HscB" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2U6 at UniProt or InterPro

Protein Sequence (208 amino acids)

>AMB_RS15240 Fe-S protein assembly co-chaperone HscB (Magnetospirillum magneticum AMB-1)
MNAPAAAQIVSCWSCKGPVATRALFCSVCGAVQGPGNIDHFSRLGIPPSFDLDLDALQHQ
YFGFQKRLHPDRFASKSPKEKALSQSQATSLNEAYETLKDPLKRAAYLLNHLGHPVDLTA
CGTINDRELLMEQMEKREALAEASTPEEIAKLAMAAESEVIACQCHISAAINAADLEEAG
HLTIRLKYLAKLAEEARAKKTRALRLPS