Protein Info for AMB_RS15210 in Magnetospirillum magneticum AMB-1

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF00733: Asn_synthase" amino acids 13 to 141 (129 residues), 30.9 bits, see alignment E=5.9e-11 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 14 to 367 (354 residues), 315.5 bits, see alignment E=2e-98 PF03054: tRNA_Me_trans" amino acids 14 to 217 (204 residues), 225.1 bits, see alignment E=1.8e-70 PF20259: tRNA_Me_trans_M" amino acids 233 to 287 (55 residues), 62.6 bits, see alignment 5.1e-21 PF20258: tRNA_Me_trans_C" amino acids 296 to 367 (72 residues), 70.6 bits, see alignment E=2.9e-23

Best Hits

Swiss-Prot: 100% identical to MNMA_MAGSA: tRNA-specific 2-thiouridylase MnmA (mnmA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to mag:amb3019)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2V2 at UniProt or InterPro

Protein Sequence (373 amino acids)

>AMB_RS15210 tRNA 2-thiouridine(34) synthase MnmA (Magnetospirillum magneticum AMB-1)
MNTLDIDKPPSSTRVVVAMSGGVDSSAVAALLKEQGYDVVGVTLQLYDLATSGIEPGACR
PNTCCAGKDIHDARAVADALGIPHYVLDFEETFRRDVVERFAQTYLEARTPVPCIECNRT
VKFRDLLGVAKDLGGDALATGHYVRRRPGVDGPELWTGRDPGRDQSYFLFATTRDQLDFL
RFPLGDMAGKEETRAIAARHHLPVAAKRDSQDICFVPDGDYAALVTRLHPDAARPGEIVD
TAGKVLGRHGGLIHYTIGQRRGLGLGGGPPLYVVALEPETGRVVVGSREDLNCLTIQVEA
VNWLGGDETELRVAVKVRSTRPAAPALLRRLSGDRAQVILDHPEQGVAPGQACVFYQGER
VLGGGWICPSREA