Protein Info for AMB_RS15165 in Magnetospirillum magneticum AMB-1

Annotation: MCE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details PF02470: MlaD" amino acids 51 to 141 (91 residues), 52.4 bits, see alignment E=2.6e-18 amino acids 166 to 226 (61 residues), 31.1 bits, see alignment E=1.1e-11 amino acids 294 to 398 (105 residues), 44.2 bits, see alignment E=9.6e-16

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 100% identity to mag:amb3011)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2W0 at UniProt or InterPro

Protein Sequence (535 amino acids)

>AMB_RS15165 MCE family protein (Magnetospirillum magneticum AMB-1)
MPSADSPSPQRPAEPRILPPRRWLPSAIWIIPALAALFALSLVIHALNQRGPAITVYFAS
AQGIEAGKTKVKFKDVEIGDVTELHLAPDRTRVQVRIELKKEAEGFAVEDSRFWVVRPRM
AGSGVSGLETLLSGSYIGVDGGHSDKKSTEFTGLEVPPVIASDMPGRRFVLVARDIGSLD
VGSPVFFRRIPVGHIESYALQPDGHSLFLSAFVKAPYDRFVTDGTRFWHASGVDLRLDAG
GLKLNTQSLAAMLLGGVAFESPDGNIEAPEAAPATRFALAADHDSALKAPDGEAYPLVLR
FHQTVRGLTIGAPVDFRGAELGQVRAITMAYDRETADFTPVVTVDVYPDRLDVVGADPKP
LTDEQRQRRLVELVRRGLRAQLRTGNLVTGQLYVALDFFPNAPPVKLNPAAEPPELPTVP
GDFEELYKQVQAILRKLDKVPLDAIGQNLHATMKHLDAMTARTDKEVLPELRDSLKEMRA
SMESLTAAMAGDAPLQQDTRQALKGLTEATRSLKRLTDSLDRQPESLLQGRKEQQ