Protein Info for AMB_RS15095 in Magnetospirillum magneticum AMB-1

Annotation: LamB/YcsF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF03746: LamB_YcsF" amino acids 5 to 237 (233 residues), 309.4 bits, see alignment E=9.3e-97

Best Hits

Swiss-Prot: 52% identical to PXPA_METCA: 5-oxoprolinase subunit A (pxpA) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K07160, UPF0271 protein (inferred from 100% identity to mag:amb2997)

MetaCyc: 49% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2X4 at UniProt or InterPro

Protein Sequence (251 amino acids)

>AMB_RS15095 LamB/YcsF family protein (Magnetospirillum magneticum AMB-1)
MALRVDLNSDLGEAMGDDEAMLGVVSSANIACGFHAGDAMVMSRTVQAAMARGVGIGAHP
GYADREGFGRRPMSLSAAGIEAILAYQIGALQGIARACGATVRHVKPHGALSNLAAVDRE
AALAVARAIRAADAGLIFLAPSGSAMVAAGHEVGLAVVEEVFADRNYDPAGNLLPRSHPQ
AMIHDPQEAAANVLRMVTQGTLRSLDGKDIPCRAQSVCVHGDDPHAVALARHLRDVLTGA
GIAIVPLADLV