Protein Info for AMB_RS15005 in Magnetospirillum magneticum AMB-1

Annotation: two-component system response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 830 PF00072: Response_reg" amino acids 13 to 124 (112 residues), 72.9 bits, see alignment E=1.1e-23 TIGR00229: PAS domain S-box protein" amino acids 140 to 265 (126 residues), 87.9 bits, see alignment E=6.1e-29 amino acids 272 to 389 (118 residues), 71.6 bits, see alignment E=6.3e-24 PF13188: PAS_8" amino acids 145 to 186 (42 residues), 37.7 bits, see alignment 5.8e-13 amino acids 272 to 310 (39 residues), 32.5 bits, see alignment 2.5e-11 PF00989: PAS" amino acids 145 to 251 (107 residues), 42 bits, see alignment E=3.9e-14 amino acids 272 to 379 (108 residues), 45.8 bits, see alignment E=2.5e-15 PF08448: PAS_4" amino acids 150 to 262 (113 residues), 30.4 bits, see alignment E=1.8e-10 amino acids 274 to 384 (111 residues), 34.8 bits, see alignment E=7.9e-12 PF13426: PAS_9" amino acids 156 to 259 (104 residues), 46.9 bits, see alignment E=1.3e-15 amino acids 279 to 380 (102 residues), 61.9 bits, see alignment E=2.8e-20 PF08447: PAS_3" amino acids 167 to 250 (84 residues), 47.3 bits, see alignment E=9.2e-16 amino acids 290 to 375 (86 residues), 26.6 bits, see alignment E=2.6e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 389 to 552 (164 residues), 148 bits, see alignment E=2.1e-47 PF00990: GGDEF" amino acids 393 to 549 (157 residues), 180.5 bits, see alignment E=9.5e-57 PF00563: EAL" amino acids 571 to 805 (235 residues), 236.4 bits, see alignment E=1.4e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2980)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2Z1 at UniProt or InterPro

Protein Sequence (830 amino acids)

>AMB_RS15005 two-component system response regulator (Magnetospirillum magneticum AMB-1)
MSEPPPQPSALTVLVVEDNPGDARLVELYLHEDPARPFKVVKAARLSEGLAALQAQPIDV
VLLDLSLPDSFGMDSLARLRAANPGIPVVVLTGTSDEALALEALRQGAQDYLVKGQGDGE
LVRRAIRYAIGRSAADAALRTSESRFRALFDNAGTGVILSDAAGAYIHCNPAFCTMVGYS
DAELQKMTYRDITYPEDMNAHTQMRDDMMAGRTDSYELTKRYIRRDGNILWARLTVTAMR
EGSDNELRFTVAVVEDVTEKKRLEDHMRLAATVFESTGEGLFVTDEKRQIIHVNPAFTEL
TGYPADEVIGRTPKFLASGRHTPEFYDAVFKTLAECGKWQGEIWNRRKTGEMFAEWLNIS
VVRNERGELTNYVAVFSDITSRKQDEERLNYQANHDPLTRLPNRTLFQERLTRALTRAHR
NQAIVALLFIDLDFFKQVNDTLGHLAGDILLQQVAERLTSCVRQGDTVARLAGDEFTVIL
EEISEPRDGAVVAHKILSLLAEPFDLQGHEARISSSIGVALYPSDGGDAQTLIKLADAAM
YRAKHQGRNACRFHSESINAQAFERLALESALRHAVERREFLLHYQPIFDARSGSVVAVE
ALLRWRHPDFGMIMPNQFLPLAEETGLIMPVGKFVLDEACRQAKAWLDAGHTGLKVGINL
SSRQLRAPELIEDIAAALEGSGLPPSALELDVPESAIIDKGQDVDAIFTQFKTLGVRMAI
DAFGSGYSSFAFLRKLPSNTLKIDQGFVRDAASGAEESEIVTAIVAVARGLHLSVVAPGI
ETEEQLAHLVKYDCDMVQGFLFAHPMPAEELTEFLRAGKRPDSLPVRTTA