Protein Info for AMB_RS14980 in Magnetospirillum magneticum AMB-1

Annotation: citrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 29 to 58 (30 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 67% identity to app:CAP2UW1_0553)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>AMB_RS14980 citrate transporter (Magnetospirillum magneticum AMB-1)
MTIFGIPLEFVLFAATLLGVALLHNHTLYVGLAGLGTISLYKIAVTGFKTGAGLAGFAAH
LGHEWVTVANLFCLLMGFALLSRHFEKSHIPVVLPKYLPDDWKGGFVMLVMVFVISSFLD
NIAAALIGGAMAHQLFRAKVHVGFLAAIVAASNAGGSGSVVGDTTTTMLWIAGVPPGQVF
EAYTAAGVALVITGVIAAKQQHAYSPILKTTHAHTHVDWGRVGIVAVILISAMLTNVVVN
LSAPQMADKFPFIGGAVWIAVVATMSVRRPDWEIMPETAKGSVFLLSLVLCASMMPVEQL
PAASAFTALQLGFVSAVFDNIPLTALAIKQGGYDWGYLAYAVGFGGSMIWFGSSAGVALS
NMYPEAKSVGNWLKQGWHVTLAYVVGFAVMWALVPWRPDGLP