Protein Info for AMB_RS14965 in Magnetospirillum magneticum AMB-1

Annotation: DUF2339 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 868 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 68 to 84 (17 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 218 to 234 (17 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 293 to 318 (26 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details amino acids 448 to 467 (20 residues), see Phobius details amino acids 473 to 491 (19 residues), see Phobius details amino acids 503 to 523 (21 residues), see Phobius details amino acids 529 to 545 (17 residues), see Phobius details amino acids 557 to 576 (20 residues), see Phobius details amino acids 588 to 607 (20 residues), see Phobius details amino acids 614 to 635 (22 residues), see Phobius details amino acids 655 to 672 (18 residues), see Phobius details amino acids 683 to 701 (19 residues), see Phobius details amino acids 718 to 738 (21 residues), see Phobius details amino acids 748 to 766 (19 residues), see Phobius details amino acids 785 to 804 (20 residues), see Phobius details amino acids 811 to 831 (21 residues), see Phobius details amino acids 837 to 857 (21 residues), see Phobius details PF10101: DUF2339" amino acids 103 to 391 (289 residues), 201.9 bits, see alignment E=1.3e-63 amino acids 422 to 860 (439 residues), 225.9 bits, see alignment E=6.6e-71

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2974)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W2Z7 at UniProt or InterPro

Protein Sequence (868 amino acids)

>AMB_RS14965 DUF2339 domain-containing protein (Magnetospirillum magneticum AMB-1)
MFILTLIGGLLVLGFVVGLPVAALSARSLALRLERELKGVKGRLAEVEARLAELQRPPEA
PPAEAPPPEPVTVVVAAPLLPIAVDVPRPKPAKPMGTEKALTERWLVWLGGITLALGGAF
LVKFSVEQGLLGPAVRVSLGGLTGLATMVLGHVLARTRIADRTWHLPSVLVGAGASMVFA
SLFAAYALYHFLDPMLAFAGLGLVAAATVLLSLAHGPFVAMLGLAGGFAVPLLVRTSEPN
ALGLFAYLLALAAGTLALLRWRQWWWLAWMTLGGTAGWVLLWLITAYRLGDELVLGVFLA
ALAALFAAFRLGIPAVPAFAQRAEAPMVRQVILVAGGVIAATALAVTSVADFSSASLALL
FALELGYLAFAWRDQEFDRLPYLAAVLAVAVLASWDAGLPEIGQFTDILGRPLPHEAERF
AWVAALSAALFGAAGFAAAERAQRPPRWAAVSVGAPLAILAATYWRLHSTAGGWLWTGGA
LALGLAFLLAAERISRRRGEDGMDGALGAYAVGVVGAMALAATIAFEEAWLTVTLSLLVA
GTAWIESRLRIADLRKVALVLACVILVRLGLNPYVLDYHIAGPSAFNWLLYGYGIPLAAF
LAAARLFRSSADDVLVQVLEAGAIAFAVLLVSLEIRHLMAGGFGPGAGYSLTEQSLHSIA
WLSGAAVLLAIHRRGGRLVPLRGAQVLAVLATVQVVLLQSLMQNPLLTGASVGERLILDP
LLLAFAAPAALYGLLARLAPRSPPWDKPACVALALALGFLWAMLETRHAFAGANLRLGAV
GQAEMWAYSVVALLGGVAVLSGGIRFGSAILRHTGLAVVMLVVVKVFLVDLSRTSGLWRA
LSFLGLGAALMGIGWLYRRFVRLEDTTP