Protein Info for AMB_RS14465 in Magnetospirillum magneticum AMB-1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 183 to 209 (27 residues), see Phobius details amino acids 224 to 252 (29 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 11 to 277 (267 residues), 127.9 bits, see alignment E=2.1e-41

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to mag:amb2873)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W398 at UniProt or InterPro

Protein Sequence (286 amino acids)

>AMB_RS14465 branched-chain amino acid ABC transporter permease (Magnetospirillum magneticum AMB-1)
MDFWFFLIQVLNGVQYGLLLFLVASGLTLIFGIMGIINLAHGAFYMLGAYLAYWLARTTG
SLGAAVLLSLPIAAAIGYGIEALLVRTLYRRDHLDQVLLTYGLILIFNEATRMIWGADVH
GVAVPAALNWSIRLTDTLSYPVYRLMLSGVCAVLAVGMYLVITRTRFGMWVRAGASNRDM
VAALGINVKLLFGVVFALGAALAGLAGAISTPITSVAPGMGDSVLILCFVVVVIGGVGSI
KGAFLGAMLIGLADTFGKVFAPDFASFTVYGVMAAVLLWKPRGLFS