Protein Info for AMB_RS14120 in Magnetospirillum magneticum AMB-1

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF00892: EamA" amino acids 2 to 135 (134 residues), 77.7 bits, see alignment E=5.5e-26 amino acids 150 to 282 (133 residues), 47.7 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2808)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3G3 at UniProt or InterPro

Protein Sequence (295 amino acids)

>AMB_RS14120 EamA family transporter (Magnetospirillum magneticum AMB-1)
MRAVILLALLVLIWGGNWPIMKIGLAHIQPLWFCAFRLALGVVSMVIILVPLGRLRLPPR
GDWPVLMSLGLLNMALFMVLSNLALLVVPAGRSAILAYTTPLWVAPGAALFLGEKLTGGR
MAGVLLGLGGIVVLFNPLSFDWGNHDAVVGNLMLLAAALVWAAAILHVRGHRWCSSPLDL
APWQMVIGLVPVAAAALIEGAPRPDGSFELAWTLIYNGTLATAFAFWAAVTVNRLLPALT
VSLSFLCVPAGGLVFSALMLGEGLSLTNVAGLALIAGGVGIVALVGARERRAASA