Protein Info for AMB_RS14065 in Magnetospirillum magneticum AMB-1

Annotation: HTH domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08279: HTH_11
  • amino acids 12 to 65 (54 residues), 50.3 bits, 4.3e-17
• PF13280: WYL
  • amino acids 143 to 208 (66 residues), 49.4 bits, E=9.2e-17
• PF02798: GST_N
  • amino acids 256 to 326 (71 residues), 45.4 bits, E=2.1e-15
• PF13409: GST_N_2
  • amino acids 269 to 327 (59 residues), 48 bits, E=4e-16
• PF13417: GST_N_3
  • amino acids 269 to 331 (63 residues), 41.3 bits, E=4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2796)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See Q2W3H5 at UniProt or InterPro

Protein Sequence (462 amino acids)

>AMB_RS14065 HTH domain-containing protein (Magnetospirillum magneticum AMB-1)
MVYGVPMSRTDRLFGLLQSLRRHRRPVSGADLAAEAGISLRTLYRDVATLQGLGAEIDGE
PGLGYVLKPGFLMPPLMFSDEEIQALALGARWVARRTDADLARAARNAMAKIASVVPPDL
HRKLDDDALIIGPGWEKPQAVGLDTLRQALNHERKLALSYRDEKGVRTERVVWPVVLGFF
ETTRVLAAWCELRGGFRHFRTDRIEAAELLSYRPPRPRRSLMAEWRKTMLTETDSSRAYK
SSPPKPRTETPMSKDLIFYTHPQSRGNIVHWMLEEIGGPYRIEVKEYGTTMKAPDYLAIN
PMGKVPAIRHGDTVVTESAAIVAYLADAFPEAGLAPPLAERGEYYRWLFFTAGCGEPAIS
NHSVGWDPTTPDLQGRFGYGSFPLVMDTLSQAVRGKRFVAGDRFSAADVYLGSLLHWAMR
FGIIDRRPEFETYCEGLISRPAALRAREQAEKLASQHAWTTS