Protein Info for AMB_RS14010 in Magnetospirillum magneticum AMB-1

Annotation: NADH-quinone oxidoreductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details PF00507: Oxidored_q4" amino acids 24 to 120 (97 residues), 137.4 bits, see alignment E=8.1e-45

Best Hits

Swiss-Prot: 68% identical to NU3M_TETSU: NADH-ubiquinone oxidoreductase chain 3 (ND3) from Tetraselmis subcordiformis

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 100% identity to mag:amb2787)

MetaCyc: 40% identical to ferredoxin-plastoquinone oxidoreductase subunit C (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3I4 at UniProt or InterPro

Protein Sequence (121 amino acids)

>AMB_RS14010 NADH-quinone oxidoreductase subunit A (Magnetospirillum magneticum AMB-1)
MEAWLLEYLPILIFLGIAIVISAICVGASWIVARQKPDTEKATAYECGFDAFGDARSKFE
VRFYLVAILFIIFDLEVAFLFPWAVALGKIGMFGFWSMMVFLGVLTIGFIYEWRKGALEW
E