Protein Info for AMB_RS14005 in Magnetospirillum magneticum AMB-1

Annotation: NADH-quinone oxidoreductase subunit NuoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 41 to 182 (142 residues), 257.6 bits, see alignment E=1.4e-81 PF01058: Oxidored_q6" amino acids 67 to 176 (110 residues), 96.6 bits, see alignment E=4.7e-32

Best Hits

Swiss-Prot: 100% identical to NUOB_MAGSA: NADH-quinone oxidoreductase subunit B (nuoB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 100% identity to mag:amb2786)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3I5 at UniProt or InterPro

Protein Sequence (188 amino acids)

>AMB_RS14005 NADH-quinone oxidoreductase subunit NuoB (Magnetospirillum magneticum AMB-1)
MGVNPSAGGILSPDHAAALPPGPAQDALLKAVTTEISDKGFVLASVDAVVNWARTGSLWP
MTFGLACCAVEMMHAGCSRYDMDRFGVVFRPSPRQSDLMIVAGTLTNKMAPALRRVYDQM
AEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPSAEALMYGILQLQKKI
RRTGSILR