Protein Info for AMB_RS13900 in Magnetospirillum magneticum AMB-1

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 34 to 334 (301 residues), 165.3 bits, see alignment E=8.7e-53 PF25973: BSH_CzcB" amino acids 59 to 184 (126 residues), 33.5 bits, see alignment E=6.2e-12 PF25917: BSH_RND" amino acids 60 to 179 (120 residues), 30.2 bits, see alignment E=6.6e-11 PF25984: BSH_YknX" amino acids 68 to 170 (103 residues), 33 bits, see alignment E=8.2e-12 PF25954: Beta-barrel_RND_2" amino acids 192 to 263 (72 residues), 40.6 bits, see alignment E=4.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2764)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3K7 at UniProt or InterPro

Protein Sequence (335 amino acids)

>AMB_RS13900 efflux RND transporter periplasmic adaptor subunit (Magnetospirillum magneticum AMB-1)
MYKRLLRQAPLLLILLTLAAAGGWWWWRVSAPEVEVVMPRRGAAVEAIYATGTVEAEKWA
RIAPVVPGRIAEILAFEGDAVKEGQPLARLDDREARARIAELEAKAAYWREEMARSATLT
ARGYRSTEATQKARSEYNQVTAAINAARQKRTDLLVTSPMDGMVLKRDGEIGELAEVKDA
LFWVGAPRPLRITAEVDEEDIARVRIGQKVLIKADAFAERVLEAKVDRVTPKGDPVNKTF
RVRVVLPDDTPLLVGMTTEINIITAEHADVLLVPITALRDGKVLVVQDGRTAAIAIQTGI
RGRTMVEVTQGLGPETALIASPPSSLKAGDRVRVK