Protein Info for AMB_RS13845 in Magnetospirillum magneticum AMB-1

Annotation: phenylacetic acid degradation protein PaaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR02286: phenylacetic acid degradation protein PaaD" amino acids 30 to 140 (111 residues), 134.6 bits, see alignment E=1.7e-43 TIGR00369: uncharacterized domain 1" amino acids 30 to 139 (110 residues), 71.6 bits, see alignment E=5.7e-24 PF03061: 4HBT" amino acids 59 to 132 (74 residues), 54.9 bits, see alignment E=4.5e-19

Best Hits

Swiss-Prot: 43% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 100% identity to mag:amb2753)

MetaCyc: 43% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein paaI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3L8 at UniProt or InterPro

Protein Sequence (151 amino acids)

>AMB_RS13845 phenylacetic acid degradation protein PaaD (Magnetospirillum magneticum AMB-1)
MPQRASDETQRQALAERVGAAIGERDTASRLLGTVLDAIRPGYARMSLTVSDQMLNGVGI
GHGGITYTLADTAFAYACNSYNRPAVALSCTITYPAAARLGDRLTAECREVHRKGRNGTY
DCTVTNQSGEVVALFRGQCRILEGHIVEGSP