Protein Info for AMB_RS13790 in Magnetospirillum magneticum AMB-1

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 66 to 105 (40 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details PF00892: EamA" amino acids 144 to 275 (132 residues), 58.3 bits, see alignment E=5.4e-20

Best Hits

Swiss-Prot: 58% identical to Y1977_PSEAE: Uncharacterized protein PA1977 (PA1977) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to mag:amb2742)

Predicted SEED Role

"FIG01289198: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3M9 at UniProt or InterPro

Protein Sequence (279 amino acids)

>AMB_RS13790 EamA/RhaT family transporter (Magnetospirillum magneticum AMB-1)
MVAPRTWGLTAITMVAFAANSLLCREALRHTAIDPASFTLIRVASGAAILALLVRLRHGA
ARGGNWGSALALAGYAVAFSFAYLSLSAGTGALLLFGAVQMTMIGRGLMAGERFRPLQTV
GLLLAVGGLVVLLLPGVTAPEPVGAGLMVVAGVAWGIYSLRGRRESDALAANAGNFLRGV
PLAALACLAVVTVGEPRIDGPGLAYALASGGVASGLGYALWYVAVRGLPATHAATVQLSV
PVITALAGAALLGESLSLRLALASLAVLGGIALVVVRRR