Protein Info for AMB_RS13755 in Magnetospirillum magneticum AMB-1

Annotation: alpha-glucosidase/alpha-galactosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02056: Glyco_hydro_4" amino acids 6 to 177 (172 residues), 147 bits, see alignment E=4.9e-47 PF11975: Glyco_hydro_4C" amino acids 197 to 400 (204 residues), 117.7 bits, see alignment E=7.5e-38

Best Hits

KEGG orthology group: K07406, alpha-galactosidase [EC: 3.2.1.22] (inferred from 100% identity to mag:amb2735)

Predicted SEED Role

"Alpha-galactosidase (EC 3.2.1.22)" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Galactosylceramide and Sulfatide metabolism or Lactose and Galactose Uptake and Utilization or Melibiose Utilization (EC 3.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3N6 at UniProt or InterPro

Protein Sequence (425 amino acids)

>AMB_RS13755 alpha-glucosidase/alpha-galactosidase (Magnetospirillum magneticum AMB-1)
MKNITKIAFLGAGSMSFGLSTFRDMFSSDTLAGSTLVLVDHNPEALARMKALAERMNAEG
KAGMIIESTTDRREAFDGASVVINSVAIDRMRLWKHDFEIPKKYGIRQTLGENGGPGGLF
FTMRTLPLIFEITRDMEELCPDALFLNFSNPESRIVLALGKYSPIKSMGLCHGIFMARGA
ICHITGVPWHDAECWGIGLNHFQWMLQVRNRWTGEDMYPLLRAKEPGFDPTFQPFSRKMF
NIYGLWPSCSDDHMGEYLAFGWEGGEHGHDYAGDARERVELQEAIEGVLAGGPLPDEWKH
SVGERTNVVVDGLINNRHHYLESAVLMNNGTIPNLPPDLAVEVPAIVDAAGVHPVSLGPL
PESIQKLALVQAGVQQLSVEAAVHASKELALQALLADPVVNSSDAAVKLLDELWEINKPY
IRKCV