Protein Info for AMB_RS13255 in Magnetospirillum magneticum AMB-1

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12418: AcylCoA_DH_N
  • amino acids 3 to 34 (32 residues), 48.8 bits, see alignment (E = 1.7e-16)
• PF02771: Acyl-CoA_dh_N
  • amino acids 76 to 157 (82 residues), 48.5 bits, E=3.3e-16
• PF02770: Acyl-CoA_dh_M
  • amino acids 162 to 264 (103 residues), 55 bits, E=2.3e-18
• PF00441: Acyl-CoA_dh_1
  • amino acids 279 to 444 (166 residues), 88.8 bits, E=1.3e-28
• PF08028: Acyl-CoA_dh_2
  • amino acids 295 to 436 (142 residues), 23.1 bits, E=2.3e-08
• PF12806: Acyl-CoA_dh_C
  • amino acids 460 to 587 (128 residues), 96.8 bits, E=3.2e-31

Best Hits

Swiss-Prot: 50% identical to DMDC_RUEPO: 3-methylmercaptopropionyl-CoA dehydrogenase (dmdC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to mag:amb2634)

MetaCyc: 50% identical to 3-(methylsulfanyl)propanoyl-CoA dehydrogenase monomer (Ruegeria pomeroyi DSS-3)
RXN-12572 [EC: 1.3.99.41]

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

• oleate β-oxidation (27/35 steps found)
• adipate degradation (5/5 steps found)
• fatty acid salvage (5/6 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methylthiopropanoate degradation I (cleavage) (1/6 steps found)
• superpathway of dimethylsulfoniopropanoate degradation (1/8 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.- or 1.3.99.41

Sequence Analysis Tools

See Q2W3Y7 at UniProt or InterPro

Protein Sequence (592 amino acids)

>AMB_RS13255 acyl-CoA dehydrogenase (Magnetospirillum magneticum AMB-1)
MTTYIPPLRDIRFTMEEVVGLDAITALPGFEDATSETADSILTEAGHIAEGVLSPLNRAG
DEDGARQENGVVRTTPGWKDAWATIVEGGWNGLPFSPDFGGMGLPNLFNHAVHEMWQAAN
MAFTLNPMLTQGAVNALSLYGSEEQKAYYLPKMVTGEWTGTMNLTEPQAGSDLAAIRTKA
APEGDKFRLSGQKIFITYGDHDLADNIIHLVLARLPDAPAGVKGISLFVVPKMLPDGSRN
DVKCVSLEHKLGIHGSPTAVMSFGDHEGALGELVGQPHRGLEYMFVMMNHARLAVGLQGL
AIAERAYQQARNYARDRVQGKPVGWTGSGPASIVHHPDVRRLLMTMKSGIEAMRGIHYTA
AAFSDIAHHHPEPNARYEASQRLEFLTPIAKGWCTELGQHIASLGVQVHGGMGYIEETGA
AQHLRDARITTIYEGTTAIQANDLVYRKILRDKGAFAHTLLAEIAALAAELSADGLASLQ
AVGTRLSEAAAAAARAVNWLVGQTGEDPRLAAAAAVPMLDLTGILVGGQQVALAAKVAKA
AMDAGRDHDGFYAAKLATAHFYAEHTLPQAAALERTIIAGSATVMGVDEAIL