Protein Info for AMB_RS13255 in Magnetospirillum magneticum AMB-1

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 PF12418: AcylCoA_DH_N" amino acids 3 to 34 (32 residues), 48.8 bits, see alignment (E = 1.7e-16) PF02771: Acyl-CoA_dh_N" amino acids 76 to 157 (82 residues), 48.5 bits, see alignment E=3.3e-16 PF02770: Acyl-CoA_dh_M" amino acids 162 to 264 (103 residues), 55 bits, see alignment E=2.3e-18 PF00441: Acyl-CoA_dh_1" amino acids 279 to 444 (166 residues), 88.8 bits, see alignment E=1.3e-28 PF08028: Acyl-CoA_dh_2" amino acids 295 to 436 (142 residues), 23.1 bits, see alignment E=2.3e-08 PF12806: Acyl-CoA_dh_C" amino acids 460 to 587 (128 residues), 96.8 bits, see alignment E=3.2e-31

Best Hits

Swiss-Prot: 50% identical to DMDC_RUEPO: 3-methylmercaptopropionyl-CoA dehydrogenase (dmdC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to mag:amb2634)

MetaCyc: 50% identical to 3-(methylsulfanyl)propanoyl-CoA dehydrogenase monomer (Ruegeria pomeroyi DSS-3)
RXN-12572 [EC: 1.3.99.41]

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.- or 1.3.99.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3Y7 at UniProt or InterPro

Protein Sequence (592 amino acids)

>AMB_RS13255 acyl-CoA dehydrogenase (Magnetospirillum magneticum AMB-1)
MTTYIPPLRDIRFTMEEVVGLDAITALPGFEDATSETADSILTEAGHIAEGVLSPLNRAG
DEDGARQENGVVRTTPGWKDAWATIVEGGWNGLPFSPDFGGMGLPNLFNHAVHEMWQAAN
MAFTLNPMLTQGAVNALSLYGSEEQKAYYLPKMVTGEWTGTMNLTEPQAGSDLAAIRTKA
APEGDKFRLSGQKIFITYGDHDLADNIIHLVLARLPDAPAGVKGISLFVVPKMLPDGSRN
DVKCVSLEHKLGIHGSPTAVMSFGDHEGALGELVGQPHRGLEYMFVMMNHARLAVGLQGL
AIAERAYQQARNYARDRVQGKPVGWTGSGPASIVHHPDVRRLLMTMKSGIEAMRGIHYTA
AAFSDIAHHHPEPNARYEASQRLEFLTPIAKGWCTELGQHIASLGVQVHGGMGYIEETGA
AQHLRDARITTIYEGTTAIQANDLVYRKILRDKGAFAHTLLAEIAALAAELSADGLASLQ
AVGTRLSEAAAAAARAVNWLVGQTGEDPRLAAAAAVPMLDLTGILVGGQQVALAAKVAKA
AMDAGRDHDGFYAAKLATAHFYAEHTLPQAAALERTIIAGSATVMGVDEAIL