Protein Info for AMB_RS13215 in Magnetospirillum magneticum AMB-1

Annotation: cation acetate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details amino acids 359 to 388 (30 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 434 to 455 (22 residues), see Phobius details amino acids 466 to 491 (26 residues), see Phobius details amino acids 503 to 522 (20 residues), see Phobius details TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 64 to 473 (410 residues), 204.8 bits, see alignment E=1.2e-64 PF00474: SSF" amino acids 64 to 473 (410 residues), 374 bits, see alignment E=4.7e-116

Best Hits

Swiss-Prot: 59% identical to ACTP_PECAS: Cation/acetate symporter ActP (actP) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to mag:amb2626)

MetaCyc: 59% identical to acetate/glycolate:cation symporter (Escherichia coli K-12 substr. MG1655)
RXN0-1981; RXN0-5111; TRANS-RXN0-576

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W3Z5 at UniProt or InterPro

Protein Sequence (554 amino acids)

>AMB_RS13215 cation acetate symporter (Magnetospirillum magneticum AMB-1)
MKRILPILLALAVPTAALAGPGDLGGSEKQPINVTAIAMFFAFVMGTLGITYWASKRTKS
ASDFYTAGGGITGFQNGLAIAGDYMSAATLLGLSSMVFATGFDGFIYTISFFVGWPIILF
LLAERLRNLGRYTFADIASYRLDQSKVRTFAAMGSLTVVCFYLIVQMVGAGQLIKLLFGL
DYAVAVIIVGVLMVVYVTFGGMIATTWVQIIKACLLLGGGVLLCALALSKFGFSLENVAA
KAVESHKAGVKIMGPGTMLADPVSAVSLSLGLVFGTAALPHILMRFFTVPNAKEARKSVF
VASGFIGFFFLIVCILGLAAVSIVGTDPQFFEGGKVGGKLLGGGNMPVMHLAKALGGDIF
LGFLSAVAFATILAVVSGLALAGASAIAHDIYARVIRKGHATEAEEMRVSKLSSLVLGVV
AVILGIMFEKQNVAFLVGLTFGIAASANFPVLFLSMYWRGLTTKGALWGGIAGLVSAVTC
VVLSKAVWVVVLNNPAPIFPYEHPALFSMTLAFLVTIVVSKLDGSETAKAEKALFDDQYV
RAQTGIGAASASNH