Protein Info for AMB_RS13150 in Magnetospirillum magneticum AMB-1

Annotation: electron transport complex subunit RsxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details TIGR01943: electron transport complex, RnfABCDGE type, A subunit" amino acids 3 to 190 (188 residues), 258.7 bits, see alignment E=2.4e-81 PF02508: Rnf-Nqr" amino acids 5 to 190 (186 residues), 176.9 bits, see alignment E=1.9e-56

Best Hits

Swiss-Prot: 63% identical to RNFA_AROAE: Ion-translocating oxidoreductase complex subunit A (rnfA) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K03617, electron transport complex protein RnfA (inferred from 100% identity to mag:amb2613)

MetaCyc: 51% identical to Rnf complex RnfA subunit (Acetobacterium woodii)
TRANS-RXN-276 [EC: 7.2.1.2]

Predicted SEED Role

"Electron transport complex protein RnfA" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W408 at UniProt or InterPro

Protein Sequence (193 amino acids)

>AMB_RS13150 electron transport complex subunit RsxA (Magnetospirillum magneticum AMB-1)
MQHYLLLIISAALVSNVVLMRFLGLCSFMGVTTRVDTAVGMGAATTFCITVSAMLDWGLE
HFLLEPYELGYLRTVAFILVIAAAVQFTEAVVRKVSPAMFQMLGIYLPLITTNCAVLGVN
LLLVEGKMNFIESTLFALASSLGYSLVMVLFAGLRERIALNAVPRLFAGPPIGFITASLL
ALAFMGFSGMSTN