Protein Info for AMB_RS12945 in Magnetospirillum magneticum AMB-1

Annotation: lipoprotein-releasing system transmembrane subunit LolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 22 to 49 (28 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 315 to 342 (28 residues), see Phobius details amino acids 351 to 368 (18 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 6 to 414 (409 residues), 486.4 bits, see alignment E=3.5e-150 PF12704: MacB_PCD" amino acids 31 to 241 (211 residues), 71.4 bits, see alignment E=1.4e-23 PF02687: FtsX" amino acids 274 to 407 (134 residues), 60.6 bits, see alignment E=1.6e-20

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to mag:amb2572)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W449 at UniProt or InterPro

Protein Sequence (414 amino acids)

>AMB_RS12945 lipoprotein-releasing system transmembrane subunit LolC (Magnetospirillum magneticum AMB-1)
MIFNSFERMVAFRYLRARRKEGFISVIAGFSLAGIGLGVATLIVVMAVMNGFRHELLGRI
LGINGHIGVYGSGAPLSGYDPLADSIRKLPGVTRVIPTAEGQVFATSSGGGTGAIVRGVR
GQDLLTRPVFQKKYRGNPADFAGDDAVVIGKRLADKLGVRIGDSISLISPKGNVTAFGTV
PRMRGYRVVGTFDVGMFEYDSGFIFMPLEAAQTYFRLPEQVTQIEVFLENPDMVPETRKA
IWDLTGTTATIYDWQQANANFFNAIQVERNVMFLILTLIILVAAFNIISSLIMLVKDKGR
DIAILRTMGATRGMILRIFFLAGASVGVVGTVAGTVLGVAFATNIENIRQFIQSIIGREL
FAAEIYFLTQLPARVETREVVTVVLMALGLSFAATIYPAWRAAKLDPVEALRYE