Protein Info for AMB_RS12940 in Magnetospirillum magneticum AMB-1

Annotation: lipoprotein-releasing system ATP-binding protein LolD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 114.1 bits, see alignment E=7.8e-37

Best Hits

Swiss-Prot: 100% identical to LOLD_MAGSA: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to mag:amb2571)

MetaCyc: 47% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W450 at UniProt or InterPro

Protein Sequence (226 amino acids)

>AMB_RS12940 lipoprotein-releasing system ATP-binding protein LolD (Magnetospirillum magneticum AMB-1)
MNNHGLKLDNIRRAFKQGKDDLEVLKGANLEIRAGEIVALVGPSGAGKSTLLHIAGLLER
PDGGEVFLAGNPAGALGEKERTQLRRLHLGFVYQYHHLLPEFSAIENVVLPQMIAGVPQA
KARERAMELLGRMKLAERAEHRPGQLSGGEQQRVAICRALANAPRVLLADEPTGNLDPHT
ADGVFDELIRLVKGSGVAALIATHNPDLAARMDRVVKMSEGLLVEV