Protein Info for AMB_RS12530 in Magnetospirillum magneticum AMB-1

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 240 to 254 (15 residues), see Phobius details PF01148: CTP_transf_1" amino acids 3 to 250 (248 residues), 186.9 bits, see alignment E=3.4e-59

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to mag:amb2493)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4C8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>AMB_RS12530 phosphatidate cytidylyltransferase (Magnetospirillum magneticum AMB-1)
MLKTRALSALVMAPPALLAAWAGGYAFGALIALCAALMCWEWHRMLNGAFTLSGKVAALG
CSAAALLAVSRPEMGLALAALAAVVSSALAGGDRSGRGWAAFGAIYGGVPSVALVWLRGD
PTVGNAVIWWLLLVVWSTDIGAYAFGRLIGGPKLLPLVSPKKTWAGLIGGMISAGLAALL
VALAVGAAAGLAVFAAGAIVAVVAQIGDLFESWIKRRCNVKDSSNIIPGHGGVLDRVDGL
LTAALAVAALSLATGKTVLDWQ