Protein Info for AMB_RS12485 in Magnetospirillum magneticum AMB-1

Annotation: lipid-A-disaccharide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 298 to 311 (14 residues), see Phobius details TIGR00215: lipid-A-disaccharide synthase" amino acids 3 to 380 (378 residues), 264.6 bits, see alignment E=6.7e-83 PF02684: LpxB" amino acids 3 to 362 (360 residues), 316.9 bits, see alignment E=8.6e-99

Best Hits

Swiss-Prot: 100% identical to LPXB_MAGSA: Lipid-A-disaccharide synthase (lpxB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00748, lipid-A-disaccharide synthase [EC: 2.4.1.182] (inferred from 100% identity to mag:amb2484)

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4D7 at UniProt or InterPro

Protein Sequence (390 amino acids)

>AMB_RS12485 lipid-A-disaccharide synthase (Magnetospirillum magneticum AMB-1)
MLIYLIAGEPSGDLLGGRLMAALKERLGEGVSFAGIGGESMRAEGLTSLFPMTELSVMGL
VEVLPRIPKILRRVKQTISDIETKRPDALVTIDSWGFNGRIQAGLKARGVPVPRIHYVAP
MVWAWKSGRTKTLARVLDLLLTLLPNEPEWFEKEGLKTLHVGHPVIEGAASRGDGAAFRV
RHGFAPDRKLLCVLPGSRHSETAKLLAPFGETIALLARRFPDLAVVVPTVETVADEVSQA
VKSWALPSMVVRGPEKYDAFAACDAALAASGTVALELAMARLPAVITYKVSPVSAFIATR
FLGLSLKFVTLVNILVDEAVMPELLQDDCRPDKLAAAVEHLLTDEAARALQAAGARRALE
KLGLGGESPGKRAADAVIDFIRQGKEQRNG