Protein Info for AMB_RS12300 in Magnetospirillum magneticum AMB-1

Annotation: methionine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF00133: tRNA-synt_1" amino acids 5 to 221 (217 residues), 41.6 bits, see alignment E=1.5e-14 amino acids 225 to 337 (113 residues), 52.1 bits, see alignment E=9.7e-18 TIGR00398: methionine--tRNA ligase" amino acids 7 to 480 (474 residues), 521.8 bits, see alignment E=1e-160 PF09334: tRNA-synt_1g" amino acids 7 to 364 (358 residues), 376.4 bits, see alignment E=3e-116 PF01406: tRNA-synt_1e" amino acids 16 to 138 (123 residues), 33.3 bits, see alignment E=7e-12 PF19303: Anticodon_3" amino acids 396 to 512 (117 residues), 44.9 bits, see alignment E=2.4e-15

Best Hits

Swiss-Prot: 62% identical to SYM_RHILO: Methionine--tRNA ligase (metG) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01874, methionyl-tRNA synthetase [EC: 6.1.1.10] (inferred from 100% identity to mag:amb2448)

Predicted SEED Role

"Methionyl-tRNA synthetase (EC 6.1.1.10)" (EC 6.1.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4H3 at UniProt or InterPro

Protein Sequence (516 amino acids)

>AMB_RS12300 methionine--tRNA ligase (Magnetospirillum magneticum AMB-1)
MTGAGTFYVTTPIYYVNDKPHIGHAYTTLACDVLARFKRLDGFDVKFLTGTDEHGQKVEK
SAEAFGVTPQALADQNSANFRELAKILGCTNDDFIRTTEARHKAACQALWDKLVAKGDIY
LGAYEGWYSVRDEAFYAEDELVKGADGAKLAPTGAPVEWVKEPSYFFRLSAWQDRLLRWY
EDNPDCVAPQSRRNEVMSFVKGGLQDLSVSRTSFKWGIPVPGDDAHIMYVWLDALTNYIT
AVGYPDTTGDFARYWPNVIHMVGKDIVRFHAVYWPAFLMAADLPAPKRVFAHGWWTNEGQ
KISKSVGNVIDPLSLIETYGLDQVRYFLLREVPFGNDGDFSHRAMMGRMNSELANDYGNL
VQRSLSMIGKNCGGVTPAHLPDTDEDKEMLGAAYGMLAKVRDAMDRQLYHEAIEAIWVVV
RAANAYVDKQAPWALKKTDPARMGTVLWVLAETIRCLALLTQPFMPAASARILDQLMVPE
AERSFAFFGPGHALKAGISLPTPQGVFPRYVEEVSA