Protein Info for AMB_RS12025 in Magnetospirillum magneticum AMB-1
Annotation: pantetheine-phosphate adenylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to COAD_RHOCS: Phosphopantetheine adenylyltransferase (coaD) from Rhodospirillum centenum (strain ATCC 51521 / SW)
KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 100% identity to mag:amb2382)MetaCyc: 49% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]
Predicted SEED Role
"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)
MetaCyc Pathways
- superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
- superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
- coenzyme A biosynthesis I (bacteria) (4/4 steps found)
- coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
- coenzyme A biosynthesis III (archaea) (3/4 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W4N9 at UniProt or InterPro
Protein Sequence (168 amino acids)
>AMB_RS12025 pantetheine-phosphate adenylyltransferase (Magnetospirillum magneticum AMB-1) MPKRVGLYPGTFDPVTNGHMDIVARAARVVDHLIVAVAANAGKGPLFTLEERVAMAELEM AELAQSIGASIEVRSFDTLLVDFTAGCGANLIVRGLRAVSDFEYEFQMAGMNARLSPDIE TIFLMASERCQFISSRFVKEIGRLGGDISQFVSPRVKAQLDEKFGFSA