Protein Info for AMB_RS12005 in Magnetospirillum magneticum AMB-1

Annotation: HlyD family type I secretion periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 55 to 75 (21 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 56 to 468 (413 residues), 363.3 bits, see alignment E=9e-113 PF13437: HlyD_3" amino acids 320 to 426 (107 residues), 52.7 bits, see alignment E=3.2e-18

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to mag:amb2378)

Predicted SEED Role

"Membrane-fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4P3 at UniProt or InterPro

Protein Sequence (468 amino acids)

>AMB_RS12005 HlyD family type I secretion periplasmic adaptor subunit (Magnetospirillum magneticum AMB-1)
MSTNSNPGQSLVNVPQPDKTPQAAATGKSLVKLSNRQSRHLAQALVLEESGTSGLIRFTM
LLASTTTAAFVVWASFTDVPEIATAEGQIIPTGQVQAVQHLEGGIVQDILARDGDLVEAG
APIVRLNAAQAISDLEQTRAREATLLIKAERLRALAEERQPDFSNMPKGYDRLMSDNMAI
FNSQSQARDTSRSVILSQMEQKRSDLRLLESQERSLREQLGPLQEEMTMRQELVAKGLVS
RVVFLDTKRELSRVQGELARLIGQEVTAREALSEVENRLMDNKSSLQKSTMDDLGTTINE
LAQVQESIGRLEDRVARLEIIAPVRGLVKGLTVKNQGAVIQAGGNVCEVVPVETQMKVDA
KINTKDVGHLKIGQPVRVKVTTYDFARYGAVDGTLTKISASSFADEKGNPFFKGVIDLKH
NYVGLTPGRYGIQPGMSVTAEIITGDKTLLQYMLKPIFTQIQQSFHER