Protein Info for AMB_RS11780 in Magnetospirillum magneticum AMB-1

Annotation: glutamate synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 TIGR01317: glutamate synthase, NADH/NADPH, small subunit" amino acids 3 to 470 (468 residues), 685.7 bits, see alignment E=1.8e-210 PF14691: Fer4_20" amino acids 23 to 131 (109 residues), 91.1 bits, see alignment E=2.7e-29 PF00890: FAD_binding_2" amino acids 146 to 180 (35 residues), 25.9 bits, see alignment 3.7e-09 PF00070: Pyr_redox" amino acids 146 to 179 (34 residues), 22.1 bits, see alignment (E = 1.2e-07) PF01494: FAD_binding_3" amino acids 146 to 177 (32 residues), 24.8 bits, see alignment (E = 8.3e-09) PF01266: DAO" amino acids 146 to 179 (34 residues), 29.9 bits, see alignment (E = 2.8e-10) PF01134: GIDA" amino acids 146 to 176 (31 residues), 24.4 bits, see alignment (E = 9.4e-09) PF12831: FAD_oxidored" amino acids 146 to 183 (38 residues), 37.3 bits, see alignment 1.4e-12 PF07992: Pyr_redox_2" amino acids 146 to 452 (307 residues), 103.7 bits, see alignment E=8.6e-33 PF13450: NAD_binding_8" amino acids 148 to 182 (35 residues), 40.5 bits, see alignment 1.7e-13 PF01593: Amino_oxidase" amino acids 154 to 183 (30 residues), 26.7 bits, see alignment (E = 2.2e-09)

Best Hits

Swiss-Prot: 55% identical to GLTD_MYCTU: Glutamate synthase [NADPH] small chain (gltD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to mag:amb2332)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4T9 at UniProt or InterPro

Protein Sequence (472 amino acids)

>AMB_RS11780 glutamate synthase subunit beta (Magnetospirillum magneticum AMB-1)
MGKATGFKEFDRQTPGYEKPEERVKHYREFTKPLTDEELAKQGARCMDCGIPFCHQGCPV
NNLIPDWNDLVYRNRWQEASEVLHSTNNFPEFTGRVCPAPCEASCTLNITDSPVAIKTIE
HAVVERAFAEGWLVPDVAKRETGKMVAVVGGGPAGMAAAQQLARAGHSVTLFEKNAKVGG
LLRYGIPDFKLEKAIIDRRVAQMEAEGVTIKANTHVGVTFPVKDLLDGFDAVVLTGGSEK
PRDLPVPGRELKGVHFAMDFLTQQNRRNGAEAVGAEDILAKGKKVVVIGGGDTGADCVGT
SNRQGAASVTQIEIMPRPPEKEDKGLSWPLWPNRLRTSSSHDEGCARRWSVSTLRFTGKD
GQVTGLDCAEVDAKFQPIPGTEFKLEADLVLLAMGFVHPVHEGLVDGLGLEKDGRGNVKA
DTTVYQTSNPKVFAAGDIRRGQSLVVWAIREGRQAARAVDAYLMGSSDLPAC