Protein Info for AMB_RS11760 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 28 to 367 (340 residues), 370.1 bits, see alignment E=1.6e-114 PF13433: Peripla_BP_5" amino acids 159 to 366 (208 residues), 45.4 bits, see alignment E=6.4e-16

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to mag:amb2327)

Predicted SEED Role

"Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4U4 at UniProt or InterPro

Protein Sequence (404 amino acids)

>AMB_RS11760 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MVMKRLLLGAAALALSTGMAHAQYSDGKVKIGVLTDLSGTYSDLAGKGTIVAAQMAIDDF
GGKLNGQPIELISADHQNKADIASGIARKWYDTEQVDAIAELVTTAAAIAVREVSKEKGK
IDLVSGAASTPLTNDKCSATGFHWTYDTYALANGTGDAVVKNGGKTWFFLTADYAFGHNL
QAQTEKVVKANGGTVKGSVKHPFPNSDFSSFLLQAQSSGAQIIGLANAGADTINAIKQAK
EFGITQAGQSLAGLLVFITDVHSLGLENAQGMMLTTGFYWDMDDQTRAWSKRWSEKMGGG
KMPSMVHAGTYSQVLHYLRAAAAAKTDEGIKVADEMRKLPINDFFAKNGKIRADGRMVHD
MYLAQVKKPSESKGPWDYYKIIRTIPGDTAYQPLSESTCPLVKK