Protein Info for AMB_RS11745 in Magnetospirillum magneticum AMB-1

Annotation: Crp/Fnr family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00027: cNMP_binding" amino acids 26 to 113 (88 residues), 80.2 bits, see alignment E=2.7e-26 PF13545: HTH_Crp_2" amino acids 146 to 217 (72 residues), 62 bits, see alignment E=1.2e-20 PF13384: HTH_23" amino acids 169 to 200 (32 residues), 25.2 bits, see alignment 3.3e-09 PF00325: Crp" amino acids 170 to 199 (30 residues), 28.9 bits, see alignment 2.4e-10

Best Hits

Swiss-Prot: 31% identical to CRPL_CORGL: CRP-like cAMP-activated global transcriptional regulator (glxR) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: None (inferred from 100% identity to mag:amb2324)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4U7 at UniProt or InterPro

Protein Sequence (223 amino acids)

>AMB_RS11745 Crp/Fnr family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MLANTPLFASVQTDLLDELAAKAKMVKVDARETLFSKGDPGDRLYLVAKGLIRIGVLSAD
GREVTYGLIKPGQLFGEIAVLDGKERSADATAMEATELIALERKDVHTFLHRHPAQALHL
IEVLCERIRRADNQLEDMVFLSLPSRLAKHLLMLVQTMGTKAKPGTPSAIKLSQQEIADH
LGISRESVNKVLSKWEQAGIVTLGRGQITLNKTAALEGLTSLE