Protein Info for AMB_RS11705 in Magnetospirillum magneticum AMB-1

Annotation: pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03182: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  • amino acids 16 to 329 (314 residues), 505.3 bits, E=2.6e-156
• PF00676: E1_dh
  • amino acids 24 to 321 (298 residues), 341.3 bits, E=4.1e-106

Best Hits

Swiss-Prot: 67% identical to ODPA_RHIME: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 100% identity to mag:amb2316)

MetaCyc: 34% identical to 2-keto-isovalerate dehydrogenase component alpha subunit (Bacillus subtilis)
2-oxoisovalerate dehydrogenase (acylating). [EC: 1.2.1.25, 1.2.4.4]

Predicted SEED Role

"Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• L-leucine degradation I (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• L-isoleucine degradation I (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• 2-oxobutanoate degradation I (2/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• L-valine degradation I (4/8 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.1.25 or 1.2.4.1 or 1.2.4.4

Sequence Analysis Tools

See Q2W4V5 at UniProt or InterPro

Protein Sequence (332 amino acids)

>AMB_RS11705 pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha (Magnetospirillum magneticum AMB-1)
MASKKKERGAAEPTPQELIRYYREMLLIRRFEEKAGQLYGMGLINGFCHLYIGQEAVVVG
MQAVAGAADSCITSYRDHGHMLVCGMDPKGVMAELTGRAGGYSRGKGGSMHMFSREKRFY
GGHGIVGAQVPLGTGLGFAHKYSKDNGVAHVYCGDGAVNQGQVYEAFNMAALWKLPVVFV
IENNKYAMGTSTVRHAAGQELYMRGAAYGIPGEPVNGMNIIAVRDAAARALEHARSGNGP
YILEMNTYRYRGHSMSDPAKYRSKEEVTKMREQHDPIDQLKEKLLAEGLIDEAGLKEIDR
EVKVIVTEAAEFSQSSPEPDPSELWTDVLIEA