Protein Info for AMB_RS11690 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 668 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 191 to 208 (18 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details PF03924: CHASE" amino acids 95 to 222 (128 residues), 52.8 bits, see alignment E=1.4e-17 TIGR00229: PAS domain S-box protein" amino acids 309 to 432 (124 residues), 68.5 bits, see alignment E=2.9e-23 PF00989: PAS" amino acids 313 to 421 (109 residues), 45.9 bits, see alignment E=1.6e-15 PF13188: PAS_8" amino acids 313 to 364 (52 residues), 23.5 bits, see alignment 1.2e-08 PF08448: PAS_4" amino acids 324 to 427 (104 residues), 35.2 bits, see alignment E=3.7e-12 PF00512: HisKA" amino acids 447 to 510 (64 residues), 37.2 bits, see alignment E=7.4e-13 PF02518: HATPase_c" amino acids 559 to 666 (108 residues), 92.9 bits, see alignment E=5.5e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2313)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4V8 at UniProt or InterPro

Protein Sequence (668 amino acids)

>AMB_RS11690 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MGTMAGGLAIRVKWQKLSTWLPLLVAALITACSGLVLLKVYALQAERRHEAARAELLSQL
SVLRARLEYNLTAPLLISRGLVAQIVYHDGMSDADFRRAASLVIRDYDSIRNLTMSRGTV
ISSVYPEAPNRAALGVDYRTKPDQWPTVQQAITSRKPVVAGPVNLIQGGAALIGRVPVYL
PDPAGGESRLFGLISVVIDMPKVFLASGLDARLLPMELALRGRDGLGRSGEMIWGDEAVF
LRSPVEMEVTLPDGTWAMAAIPKGGWAASDGQLRVTAGMGAVLFLLTVLASFGWAFHVRR
QQRAVRLVAESEERYRALMETAPMAVVVHRDGVILFANTQATRTVRAPAGETLIGRKVLD
FVFPDDRADVAARMGAAMADPETVVGGPVRYVARDGRVVECEVITTRVTLDGEPAVLSVV
LDVSQRNQAERERERLLESLQRSNEDLQQFAYIASHDLQEPLRNVAGYVQLLGRRYRGRL
DKDADDFIAFAVQGTKRMQEMIANLLDYSLLHREDGEPACVDSRGPLDEALADLGAAMDE
SGAVVEVVGVMPVVLARRVELARIFLNLIGNAIKYRRADTVPRIRIFARRDGLTWVFSVA
DNGIGMEPAYLDRIFTLFQRLHSRETYDGTGIGLAICRKLVQHNGGRIWAESEPGQGSTF
HFSLQAAD