Protein Info for AMB_RS11640 in Magnetospirillum magneticum AMB-1

Annotation: UbiX family flavin prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 12 to 24 (13 residues), see Phobius details TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases" amino acids 9 to 189 (181 residues), 237.9 bits, see alignment E=3.1e-75 PF02441: Flavoprotein" amino acids 9 to 177 (169 residues), 140.1 bits, see alignment E=2.6e-45

Best Hits

Swiss-Prot: 55% identical to UBIX_THAAR: Flavin prenyltransferase UbiX (ubiX) from Thauera aromatica

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 100% identity to mag:amb2302)

MetaCyc: 58% identical to flavin prenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4W9 at UniProt or InterPro

Protein Sequence (191 amino acids)

>AMB_RS11640 UbiX family flavin prenyltransferase (Magnetospirillum magneticum AMB-1)
MPLNAPPTRMIVGISGASGVIYGIRVLEMLARLGVESHLVMSRAAEVTLSHESDLKVAQV
RALASRWYKAEDIGGAPASGSFRSLGMIVAPCSIRSMSEISTGVTTSLLTRAADVALKER
RRLVLMVRETPLHTGHLRSMLQLSEMGAVIAPPVPGFYAKPESLDDMVEHSVGRMLDLFG
LDCGTIRRWGE