Protein Info for AMB_RS11635 in Magnetospirillum magneticum AMB-1

Annotation: ATP-dependent 6-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00365: PFK" amino acids 5 to 310 (306 residues), 334.3 bits, see alignment E=2.9e-104

Best Hits

Swiss-Prot: 58% identical to PFKA1_NOSS1: ATP-dependent 6-phosphofructokinase 1 (pfkA1) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 100% identity to mag:amb2301)

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.11

Use Curated BLAST to search for 2.7.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4X0 at UniProt or InterPro

Protein Sequence (361 amino acids)

>AMB_RS11635 ATP-dependent 6-phosphofructokinase (Magnetospirillum magneticum AMB-1)
MTAKRIGILTSGGDCAGLNAALRAVVHRAIRNYGWKVFGIRDGSLGLMNRPLNYVEFDLK
SVGDDMLRLGGTILGTINKGDPFAYPMPDGSKKDRSQDFVDGYKELGIEALVVIGGDGSM
RILNELCRKGGIPMVGIPKTIDNDVAQTDYAIGFATALNVAGEAMDRLAPTAASHHRVMI
LEVMGRDVGHIALNAGIAGGADVVLIPEIPYTLEGIAKKIAEVRDEGRNHALMVVAEGCK
TETGESVTTLQSGGQARYGGIGQYLAARLAETVEAETRVTVLGHVQRGGMPAMRDRIIAS
AFGVYAVDLIAQGKLGRMVAWQHGQVVDVPITDVAGITRAIDPYGTLAQTARGLGIYIGE
M