Protein Info for AMB_RS11615 in Magnetospirillum magneticum AMB-1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 TIGR00526: FolB domain" amino acids 21 to 135 (115 residues), 74.1 bits, see alignment E=5.7e-25 PF02152: FolB" amino acids 23 to 132 (110 residues), 91.3 bits, see alignment E=3.1e-30

Best Hits

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 100% identity to mag:amb2297)

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25)" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4X4 at UniProt or InterPro

Protein Sequence (136 amino acids)

>AMB_RS11615 diguanylate cyclase (Magnetospirillum magneticum AMB-1)
MFVQRSQAETQPGEAPVRRLYRILVRDLVLKCLIGIHAHELLAPQRVRINVDMSVLEQAG
PLSDDIANVVSYEDVIDGIKAMLAEGHINLVETLAEKIADLCLVDERVETARIRVEKLDV
YAEAASVGIEIERGRK