Protein Info for AMB_RS11550 in Magnetospirillum magneticum AMB-1

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 79.1 bits, see alignment E=9.8e-26 PF00158: Sigma54_activat" amino acids 169 to 331 (163 residues), 230.4 bits, see alignment E=3.7e-72 PF14532: Sigma54_activ_2" amino acids 179 to 335 (157 residues), 58.7 bits, see alignment E=2.9e-19 PF00004: AAA" amino acids 188 to 321 (134 residues), 22.8 bits, see alignment E=3.7e-08 PF07728: AAA_5" amino acids 188 to 308 (121 residues), 29.8 bits, see alignment E=1.9e-10 PF25601: AAA_lid_14" amino acids 336 to 411 (76 residues), 68.3 bits, see alignment E=1.5e-22 PF02954: HTH_8" amino acids 433 to 473 (41 residues), 35.1 bits, see alignment 3.1e-12

Best Hits

Swiss-Prot: 67% identical to HOXA_BRADU: Hydrogenase transcriptional regulatory protein HoxA (hoxA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 100% identity to mag:amb2284)

Predicted SEED Role

"Hydrogenase transcriptional regulatory protein HoxA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W4Y7 at UniProt or InterPro

Protein Sequence (479 amino acids)

>AMB_RS11550 sigma-54-dependent Fis family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MTSLPIILVVDDEKQSQEALRRVLADEFQVLTASTAEEAEGLLEQEMVHAILCDQRMPGI
QGVDFLKAVRDRWPDPVRMIISGYSEAEDIIAGVNEAGIYQYITKPWEPDELVQTLHGAL
KLYSLQRENAQASLDLKVPPAALERSIARKTGTLKRQHHFDGIIHAPDSPLTEVIEMARK
VSSFDISVLITGESGTGKELLARAIHYNSPRGNKPFVVENCGALPDQLLESELFGCKKGA
FTGAYEDRIGLFEQASGGTIFLDEIGETSPAFQVKLLRVLQEGEIRPLGARLTRKVDVRV
IAATNRNLEEEVREKHFRRDLFYRLAAFPIHLPPLRERPMDVPLLAERLLGETGKGFGRP
NLRFGPEAMAQMRGYDWPGNVRELQNEIQRMVALAEHAVLSPDLLSPRLRARICPAGRAL
ADQGEPATLKEQVEMLEARLLAESLGRHRWNITRVAEETGLSRVGLRAKLRRYGLERED