Protein Info for AMB_RS11285 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 635 transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 40 to 283 (244 residues), 130.9 bits, see alignment E=5.9e-42 PF05992: SbmA_BacA" amino acids 41 to 355 (315 residues), 75.3 bits, see alignment E=5.8e-25

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to mag:amb2231)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W540 at UniProt or InterPro

Protein Sequence (635 amino acids)

>AMB_RS11285 ABC transporter ATP-binding protein/permease (Magnetospirillum magneticum AMB-1)
MASNVNNGAAIGDDQDLDRQSPGFIRQFIRLAGPYWQSGEKWKVRGLAALLLGLTVAQVV
IPILINLWSAELFDALEQKSMEKFFAQIAEIGLILVASMTVTALHLKVKRTIQLSWRRWL
TRRLQDNWMAMGHHYQLMHMPGDHDNPDGRIAEDIRLTTETAIDLIHSLFYCALLLASFV
QILWTLSGDLMLNLGGIELSIPGHMVWVALIYASAASSLALWVGRPLIGATDRRQTAEAN
FRFGLVRARENSEAIALLHGEVGERRRFSELFRGIEGAWNRQTAGLTRLFLFTSGYAVFS
TAFPILIAAPRYISGDISLGHLMQTAQAFQQLSQALSWPVDNLQRVAEWRASVERVLSLH
DALQALRDDASRPDAHTVIVQKAAIPTLCFHDLTIANSDGTVVIEGFSAEIVGGEHVLIG
GDPGAAVKLFKVVAGLWPWGRGTVDLPCDAHIFFMPQRPYMPIGTLRSVLTYPSATECFP
DDQLEGALDRVGLGHLMPRIDDTALWEQNLTAGEQQRLGFARLLLHRPKWVFLQEATDAL
DPEGERKLMQLLNDEFPTASILTVGFHAELEQYHQRKLTLTPSPDGTILVRESRKDWNQP
KRGMNWGGRLFGNLLRRGERRALSDGLTKRGDKRR