Protein Info for AMB_RS11265 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2227)

Predicted SEED Role

"Cytochrome c oxidase (B(O/a)3-type) chain I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W544 at UniProt or InterPro

Protein Sequence (348 amino acids)

>AMB_RS11265 hypothetical protein (Magnetospirillum magneticum AMB-1)
MDHSWRLGELSAARRAELRGWALLAIGSLAIAGLLALALGLSRTPKVQDWLPWGPHFFYR
ALVTHVVLSFEVWFLAALGALSAMAAPPCPKGDVLGRIALGLGSLGVALLLIPALADQGE
PSLNNYVPVVGHRLFYIGLGVHAAGVALACLRLLPVLRSQRVVPFGIACAGLAYLAALAC
FLIAWALIPAGTDSDLFNERVFWGGGHVLQLVNTMILMIAWQALSESHFGAGPVPSGLGR
AGFAALALFAVVSPLIYLVGGDVLGLEHRQVFTRLLWVGLPLPPLVMGMGLAWKLARGPR
DWRSPAFLSWRCRCSSSPSAALPGSFSAWLIPARRPTTTPSSAACNWA