Protein Info for AMB_RS11245 in Magnetospirillum magneticum AMB-1

Annotation: protoheme IX farnesyltransferase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 8 to 283 (276 residues), 282.9 bits, see alignment E=1.9e-88 PF01040: UbiA" amino acids 22 to 269 (248 residues), 161.9 bits, see alignment E=8.9e-52

Best Hits

Swiss-Prot: 100% identical to COXX2_MAGSA: Protoheme IX farnesyltransferase 2 (ctaB2) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to mag:amb2223)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W548 at UniProt or InterPro

Protein Sequence (288 amino acids)

>AMB_RS11245 protoheme IX farnesyltransferase 2 (Magnetospirillum magneticum AMB-1)
MTANLKVLASVFKLRIGVFCALAAIAGALATPGAVPDFAPVMAVALAVLLSAAAAGAFNH
YWERDIDPMMNRTRNRPFATGQFAAGPLWPLGLLALTVAAVALAAFAANAWAALHVFLGA
FVYGIVYTVWLKRRTAWNIVIGGLSGSFAVLAGAAVAVPTLSPESLILALVLFLWTPPHF
WSLATALKDDYAAAGIPMLPVVCSETETNRIILANTIALVASSLLPAFFGAGPLYLGAAI
LGGGWFLYKSVALVRRPGRKAAMGNFFASLIQLVLLLTAVMVEPLLAG