Protein Info for AMB_RS11230 in Magnetospirillum magneticum AMB-1

Annotation: heme A synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 300 to 324 (25 residues), see Phobius details amino acids 327 to 328 (2 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details PF02628: COX15-CtaA" amino acids 23 to 343 (321 residues), 339.3 bits, see alignment E=1.1e-105

Best Hits

Swiss-Prot: 100% identical to CTAA_MAGSA: Heme A synthase (ctaA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to mag:amb2219)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W552 at UniProt or InterPro

Protein Sequence (354 amino acids)

>AMB_RS11230 heme A synthase (Magnetospirillum magneticum AMB-1)
MTTMSRSFGRSDLANGAHRDVAVWLLACCFMVAVMVLLGGLTRLTHSGLSMVEWEPIRGI
IPPLNDTDWQLFFEKYKQTPEYIKVNAGMSLAEFKGIFWLEYIHRVWGRLIGVVFGLPFL
WLALSGRIGRAMVPRLAGVFLLGAAQGGMGWFMVKSGLVDNPAVSHYRLTAHLALAFLIH
GWMFWLALDILADHRSTRRRAHGDVGAVRSWMLGLTGLVIVTLLFGGLVAGLKAGLIYNT
WPLMDGAIVPKDLFPEGFHSLFEDIKTVQFGHRTLAEITIVVALVGWFRTRARLGTQTPA
AIHAVGLMALLQVGLGIGTLVMVVPVWLASAHQMGAMALLTLCLWALHDLGRRI