Protein Info for AMB_RS11175 in Magnetospirillum magneticum AMB-1

Annotation: murein L,D-transpeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF20142: Scaffold" amino acids 53 to 181 (129 residues), 58.4 bits, see alignment E=2.1e-19 PF01471: PG_binding_1" amino acids 208 to 265 (58 residues), 35.1 bits, see alignment 1.9e-12 PF03734: YkuD" amino acids 293 to 453 (161 residues), 93.6 bits, see alignment E=2.6e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2207)

Predicted SEED Role

"FIG00779127: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W564 at UniProt or InterPro

Protein Sequence (535 amino acids)

>AMB_RS11175 murein L,D-transpeptidase (Magnetospirillum magneticum AMB-1)
MLSSRPLLFSLTMGLAVLGWEAPSQAQSTAETQRRIEAAITAAPLADPALEGKALRDFYR
GRQGQAAWSGDNAALAQALLAQIRAMATAQGLEPATYALPGGAGEVDSDVLISATLLRFG
RDLAIGGVLPARNVGGFGAETRGEFDGARFLKALAEGKPLAEQMEAISPQYVGYIRLRDG
LERARAIAAAGGWPTIPDGAKLVPGETDERVPLLRRRLIASGDLADGLAEGKIYDATLAE
AVKRFQARHGLDPDATVGGKTLAHLNVPADARVRQITANLERWRWMPRSFGRHHVAVNIA
AQQMEVVEDGSVAMVMRVVVGDTKHPTPSMNTTMSSVVLNPAWRVPTSIANKEILPKLRK
DPNYLTSSKLQIVDYPEGSPESAGDGVDWNAIGKKFPYRLRQPPGPDNALGQLKFNLTDS
DDIYMHDTPNRRAFSRSYRALSHGCVRLERPVELGELMLGARWQGKLAHDINANRSTRTL
MLERTIPVYLMYWTAWADENGNLHFRDDLYGHDRRLMTALERARIPAQRPASGRS