Protein Info for AMB_RS10980 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome c

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 35 to 150 (116 residues), 40.8 bits, see alignment E=4.8e-14 PF21706: FCSD_central" amino acids 166 to 281 (116 residues), 146.3 bits, see alignment E=1.1e-46 PF09242: FCSD-flav_bind" amino acids 358 to 425 (68 residues), 93.9 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 51% identical to DHSU_ALLVD: Sulfide dehydrogenase [flavocytochrome c] flavoprotein chain (fccB) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 100% identity to mag:amb2173)

MetaCyc: 51% identical to flavocytochrome c flavoprotein subunit (Allochromatium vinosum)
RXN-8156 [EC: 1.8.2.3]

Predicted SEED Role

"Sulfide dehydrogenase [flavocytochrome C] flavoprotein chain precursor (EC 1.8.2.-)" in subsystem Sulfur oxidation (EC 1.8.2.-)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.2.- or 1.8.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W598 at UniProt or InterPro

Protein Sequence (427 amino acids)

>AMB_RS10980 cytochrome c (Magnetospirillum magneticum AMB-1)
MTAPLSRRAVLGGGAALLAAPAFLXGPAPEAKTASVVIVGGGFGGATAARSLRRAMPDLR
IVLIESTPVHVTCPGSNGVIGGLGELSRLEHGYDQLRSWFGIEVVHDSVAAIDGERRRVR
LAGGGVVAYDRLIVSPGIDLRWNDIEGYDEAAAAIMPHAWKAGAQTALLRRRLEAVEDGG
VVIIAAPGNPFRCPPGPYERASLMAWHLSRTRKGCKILVLDAKDSFSKQALFQEGWKSLY
GDMIEWVSGANNGRVVRVNAAEGWVETDFDRFTPALANIIPPQGAGRIAQAAGLADASGF
CPVDPATFESRQAPGIHVIGDACVAGEMPKSASSANGQAKIAAAAVVASLAGRGASNAKA
INVCYSLLAPDYAISVAGVYEASNGRRVAVPGSGGVSPLGADAHLRKAEAEYASGWYAGI
CADAWGG