Protein Info for AMB_RS10585 in Magnetospirillum magneticum AMB-1

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 TIGR00665: replicative DNA helicase" amino acids 21 to 495 (475 residues), 536.4 bits, see alignment E=2.5e-165 PF00772: DnaB" amino acids 21 to 120 (100 residues), 107.1 bits, see alignment E=6.7e-35 PF03796: DnaB_C" amino acids 199 to 493 (295 residues), 357.8 bits, see alignment E=4.8e-111 PF13481: AAA_25" amino acids 215 to 391 (177 residues), 58.4 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 100% identity to mag:amb2097)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5H4 at UniProt or InterPro

Protein Sequence (506 amino acids)

>AMB_RS10585 replicative DNA helicase (Magnetospirillum magneticum AMB-1)
MTSMLPDHPAAPAEGIGFRVPPHNYEAEQALLGAILLSNRAFERVSEFLKPEHFADPVHG
RIFATCGKLIERGQMANPVTLKTWFENDGGLAEIGGTNYLAQLANAVVSVINAEDYGKLI
FDLHLRRSLIGMGEDMVNDAFAPDLDVPAMDQIGKAEAKLYDLATTGQTEGGFEDFRTVL
ISAVASAEAAHKRQGKLSGVPTGLIDMDAKLGGLHDSDLIILAGRPSMGKTALATNIAFN
AAYAYKEEVDALGRKKGVDGAITAFFSLEMSSEQLAARILAEQAEINSHKIRQGEMSNEE
FEKLVVAAQNLHRLPLFIDDTPALSISAVRTRARRLQRQHGLGLIVIDYLQLLRGSSSNS
ENRVQEVSEITRGLKALAKELSVPVIALSQLSRAVEQREDKRPQLADLRESGSIEQDADV
VMFVFREQYYLERAEPGQRPEEAQEKFNERHAKWMERCEEVHNTAEVIIAKQRHGPVGTV
RLAFQGEYTKFGNLAASDHYEEPPGY