Protein Info for AMB_RS10575 in Magnetospirillum magneticum AMB-1

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 9 to 364 (356 residues), 205.1 bits, E=7.5e-65
• PF01168: Ala_racemase_N
  • amino acids 13 to 227 (215 residues), 187.5 bits, E=2.9e-59
• PF00842: Ala_racemase_C
  • amino acids 238 to 362 (125 residues), 120.7 bits, E=2.9e-39

Best Hits

Swiss-Prot: 53% identical to ALR_RHORT: Alanine racemase (alr) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 100% identity to mag:amb2095)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• alanine racemization (1/1 steps found)
• L-alanine degradation I (1/2 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• cyclosporin A biosynthesis (1/15 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• D-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

See Q2W5H6 at UniProt or InterPro

Protein Sequence (371 amino acids)

>AMB_RS10575 alanine racemase (Magnetospirillum magneticum AMB-1)
MTDLARATALLTIDVAAIVANWKRLSALVAPAEASAVVKADCYGLGMDRIAPALFAAGCR
SFFVACVNEGIALRRLLPGAMIHVLSGPMGGDEAEFAAHGLIPVLNSLSQMTGWASFAKK
GSGAPAVAIHIDTGMSRLGLSEPELERLAAKPEILAAMRPILVMSHLACADDSDSPMNAR
QLTTLRRLASHLPALPQSIAASSGIFLGRGFHLGMVRPGAALYGLNPMPGRPNPMSQVIK
LEGKIVQVRDVDSPQTVGYGATHRVEGKRRLAIVAVGYADGWFRSLSNRGHGMIGGVKVP
VVGRVSMDLTTFDVTDVPVESAHPGGLIQLIGPGYGPDHLAAEADTIGYEVLTALGRRHL
RRWIGTEGAAS