Protein Info for AMB_RS10255 in Magnetospirillum magneticum AMB-1

Annotation: phosphoribosylaminoimidazolesuccinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF01259: SAICAR_synt" amino acids 26 to 274 (249 residues), 240.5 bits, see alignment E=1.1e-75

Best Hits

Swiss-Prot: 62% identical to PUR72_AGRFC: Putative phosphoribosylaminoimidazole-succinocarboxamide synthase 2 (purC2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 100% identity to mag:amb2031)

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.6

Use Curated BLAST to search for 6.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5P0 at UniProt or InterPro

Protein Sequence (325 amino acids)

>AMB_RS10255 phosphoribosylaminoimidazolesuccinocarboxamide synthase (Magnetospirillum magneticum AMB-1)
MLSAAAIRAAIPGVLTEAEFPELPNYYRGKVRENYDLPDGRRILISTDRQSAFDQVLAAV
PFKGQVLTQTARFWFEATKDICPNHVIEYPDPNVVVGRRLDMLPIEMVVRDYLTGSTDTS
IWSMYKAGRRTMYGLDFADGMVKNDKLPATILTPTTKADVGGHDAPVSPAEVVARGLLSQ
AQWDELARLSLALFARGREIAARHGLILVDTKFEFGVDADGRITLADEILTPDSSRYWKA
DSYGARHAKGEEPESLDKEFLRIWIAARCDPYTQPIPVIPDDTLVEFSAKYISLYETVTG
QTFEAPSAAETVKERIRRNLAPYMS