Protein Info for AMB_RS10230 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00005: ABC_tran" amino acids 17 to 162 (146 residues), 109.8 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 53% identical to LIVF_SALTY: High-affinity branched-chain amino acid transport ATP-binding protein LivF (livF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to mag:amb2026)

MetaCyc: 52% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivF (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Benzoate transport, ATP binding protein" in subsystem Benzoate transport and degradation cluster

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5P5 at UniProt or InterPro

Protein Sequence (234 amino acids)

>AMB_RS10230 ABC transporter ATP-binding protein (Magnetospirillum magneticum AMB-1)
MLEVRDLDLHYGDAQALDGVSLDVAEGEVVAIIGANGAGKTSLIRAIAGMKKPSRGSIRF
EGHDIAGRASSRICDLGVAQVAEGRQIFPSMSVRENLEMGAVLPRARSKRKETLERCYEM
FPKLKVRSDQAAGTLSGGEQQMLAIGRCLMGQPRLMMFDEPSLGLAPAVVSEMFKIIKTL
HAEGMTVILVEQNVSASLKLADRGYVLENGRVVLSGTGSGLLNDDGVRQAYLGL