Protein Info for AMB_RS10220 in Magnetospirillum magneticum AMB-1

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF02771: Acyl-CoA_dh_N" amino acids 73 to 151 (79 residues), 50.9 bits, see alignment E=4.8e-17 PF02770: Acyl-CoA_dh_M" amino acids 156 to 260 (105 residues), 48.7 bits, see alignment E=1.8e-16 PF00441: Acyl-CoA_dh_1" amino acids 271 to 429 (159 residues), 98.3 bits, see alignment E=1.2e-31 PF08028: Acyl-CoA_dh_2" amino acids 289 to 418 (130 residues), 37.5 bits, see alignment E=6.8e-13 PF12806: Acyl-CoA_dh_C" amino acids 452 to 542 (91 residues), 34.2 bits, see alignment E=6.4e-12

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to mag:amb2024)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.99.- or 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5P7 at UniProt or InterPro

Protein Sequence (554 amino acids)

>AMB_RS10220 acyl-CoA dehydrogenase (Magnetospirillum magneticum AMB-1)
MIDYRTPLPDLLFALRHGAGAARLPHWDDETAETVLTHAAAMVDEVIAPLDPVGDIEGTK
LVDGRVVMPQPFVDAYRQFAGDGWQGLAVPEEDGGQGLPHILASALSEMLSGACITYQMV
LSLAHGAMRTLAASGSEAQRAAWIPRLAAGEVLATMCLTEAQAGSDLGLVRTMASPQADG
SWSISGGKIFISGGDQNLTGGQIMHLVLARTPDAPAGVKGLSLFLCPSHLEDGSRNAISV
VRLEEKMGMHASPTCQVAFDGARAEIIGAPGEGLARMFTMMNAERLDVAVQGVGLAEVAL
QRSLAYANERKQGRAGKDGGPDFIAKHGDVRRMLLAQMALAMGCRAMVMRTLVDLELGDR
PALMELMTPVAKAFATEAAMEAADHAIQVHGGYGFLREYRVEQILRDGRITRIYEGTNGI
QAATVAGRVIRLDNGRALTEFKAEVEESMGLASPAFAGALGRALAAWDEASAAMLGRRDI
GLTATSYLRLTGLLAFGAAWARLEAKAEHAANPARIRAVAEYVRDWMLPETRHLADLCRN
SAELGSLPDGVFAS