Protein Info for AMB_RS10195 in Magnetospirillum magneticum AMB-1

Annotation: 4-hydroxybenzoyl-CoA reductase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR03193: 4-hydroxybenzoyl-CoA reductase, gamma subunit" amino acids 4 to 151 (148 residues), 280.7 bits, see alignment E=1.2e-88 PF00111: Fer2" amino acids 8 to 64 (57 residues), 36.4 bits, see alignment E=6.1e-13 PF13085: Fer2_3" amino acids 24 to 79 (56 residues), 29 bits, see alignment E=1.4e-10 PF01799: Fer2_2" amino acids 75 to 147 (73 residues), 104 bits, see alignment E=5.7e-34

Best Hits

Swiss-Prot: 86% identical to HCRC_THAAR: 4-hydroxybenzoyl-CoA reductase subunit gamma (hcrC) from Thauera aromatica

KEGG orthology group: K04107, 4-hydroxybenzoyl-CoA reductase subunit gamma [EC: 1.3.7.9] (inferred from 100% identity to mag:amb2019)

MetaCyc: 86% identical to 4-hydroxybenzoyl-CoA reductase gamma subunit (Thauera aromatica)
OHBENZCOARED-RXN [EC: 1.1.7.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.7.9

Use Curated BLAST to search for 1.1.7.1 or 1.3.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5Q2 at UniProt or InterPro

Protein Sequence (162 amino acids)

>AMB_RS10195 4-hydroxybenzoyl-CoA reductase subunit gamma (Magnetospirillum magneticum AMB-1)
MKSILRLTLNGRAREDLVPDNMLLLDYLREVSNLTGTKQGCDGGECGACTVLVDDRPRLA
CSTLAHQVAGKRVETVEGLATQGTISKLQAAFHEKLGTQCGFCTPGMLMASEALLRKNPD
PSRDQIKEALAGNLCRCTGYVKIIESVEVAAKARCGCQEAAQ